DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxi3a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:155 Identity:74/155 - (47%)
Similarity:98/155 - (63%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNA 86
            ||.|.....||....:..|.             |.:.|.:.....::|:|||||.|||||||..|
Zfish    81 YGMAKQYVGASGIGGSEGAF-------------SWFSLPSQEDLMKLVRPPYSYSALIAMAIHGA 132

  Fly    87 ADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSY 151
            .::::||:.||||:.:.||:|..:|..||||||||||||:||:||.|||..||||:||||||:..
Zfish   133 PNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRHNLSLNDCFMKVPRDDSDPGKGNYWTLDPNCE 197

  Fly   152 NMFDNGSFLRRRRRFKKKDVMREKE 176
            .|||||:|.|:|:|  |.|.:.|:|
Zfish   198 KMFDNGNFRRKRKR--KSDSLAEEE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.