DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FoxL1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:373 Identity:109/373 - (29%)
Similarity:156/373 - (41%) Gaps:101/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SAAAAAHYAYDQYSRYPYSASAYG-------------------------------LGAP----HQ 64
            |..|...|...|.|..|.:.||.|                               .|.|    |.
  Fly    21 SMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCGSFSPAFYYQGIDSFLALHNNIWGLPISFLHN 85

  Fly    65 NKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFV 129
            :....|||:||||||||||.:|.::::||:|||::||::|||||:||||||||||||||||:|||
  Fly    86 SHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFV 150

  Fly   130 KVAR------DDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK--DVMREKEEAIKRQAMMN 186
            |:.|      |:...||||||.||..:.:||:.|::.|||.|.::.  ...|.:.|:.|.....|
  Fly   151 KIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGN 215

  Fly   187 EKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLA 251
            ...||::.                     ..|||.|......:..:::..:...|.....::   
  Fly   216 SSAAEIRS---------------------PSEPLSDFDIFCNERPNYSDRITDLHRQYLSVS--- 256

  Fly   252 GGGVEHPGFTVDSLMNVYN--------PRIHHSAYPYHLNEDNLATVASS-QMHHVHHAAAAHHA 307
                  .||  :||.|  |        |.|.........:..:...:.|| ::|...|:.:|...
  Fly   257 ------LGF--NSLFN--NEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTP 311

  Fly   308 QQLQRHVAHVAHPL-------------TPGGQGAGGQSSGHSPTTIST 342
            ...:|..:....|:             .||.....  ||..|.||:.|
  Fly   312 PLNRRETSSSGAPVLAEAFNGIKDVVDAPGSSPVA--SSNRSKTTLFT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/91 (64%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 58/93 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445473
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.