DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxl3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:147 Identity:76/147 - (51%)
Similarity:95/147 - (64%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SRYPYS-----ASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYY 107
            |:|||:     |..|..|:..:.|.:.:|.||||||||||||.:...:|||:|||.:||.:||||
Mouse     5 SQYPYNCFNDDADDYPAGSSDEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYY 69

  Fly   108 RDNKQGWQNSIRHNLSLNECFVKVAR---DDKKPGKGSYWT--------LDPDSYNMFDNGSFLR 161
            |.|::.||||||||||||.|||||.|   :||  |||:|||        ||     :|:||:|.|
Mouse    70 RANQRAWQNSIRHNLSLNSCFVKVPRTEGNDK--GKGNYWTFAGGCESLLD-----LFENGNFRR 127

  Fly   162 RRRRFKKKDVMREKEEA 178
            ||||...|     :|||
Mouse   128 RRRRRGPK-----REEA 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/96 (58%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.