DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxl2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:434 Identity:128/434 - (29%)
Similarity:171/434 - (39%) Gaps:136/434 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQ 115
            |.|....|..||.:.....||||||:|||||||:.:|:|::||:||||||:.:||:|..||:|||
  Rat    31 PPSPGKGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQ 95

  Fly   116 NSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIK 180
            |||||||||||||:||.|:.....||:||||||...:||:.|:: |||||.|             
  Rat    96 NSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMK------------- 146

  Fly   181 RQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLA 245
                        :|.:             ...|||  :|...|....|                 
  Rat   147 ------------RPFR-------------PPPAHF--QPGKGLFGSGG----------------- 167

  Fly   246 QMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAY--------------PYHLNEDNLATVASSQMH 296
                 ..||...||...|....:..|:...|.:              ||          ||.||.
  Rat   168 -----GAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPY----------ASCQMA 217

  Fly   297 HVHHAAAAHHAQQLQRHVAHVAHPLTPGG----QGAGGQSSGHSP----TTISTPHGPAH----- 348
            ....||||         .|..|.|.:||.    :|..|.::.:.|    .:::.|.|..:     
  Rat   218 AAAAAAAA---------AAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGL 273

  Fly   349 GGWYTPETPPSEPVPH----------NGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGG 403
            ||  .|..||..|.||          :.....|..|.|          |.......|........
  Rat   274 GG--PPAAPPPPPPPHPHPHPHAHHLHAAAAPPPAPPH----------HGAAAPPPGQLSPASPA 326

  Fly   404 SSSVLTSSPTSALGFRDMIFEQNQSCQL-----DTGSPTGSLQS 442
            :::....:||||.|.:.....|.:...:     |..|.||:|.|
  Rat   327 TAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.