DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxi1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:417 Identity:116/417 - (27%)
Similarity:160/417 - (38%) Gaps:164/417 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HYAYDQYSRYPYSASAYGLG---APHQNK------------------------------------ 66
            |:.:..:.|.|...|:||||   :|..|.                                    
Zfish    50 HHHHHHHQRPPAHPSSYGLGEYSSPSTNPYLWMNSPGITSTPYLSSPNGGSYIQSGFGSNQRQFL 114

  Fly    67 -----------------------EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYR 108
                                   ::|:|||||.||||||||||.|||:||:.||||:.:.||:|:
Zfish   115 PPPTGFGSADLGWLSISSQQELFKMVRPPYSYSALIAMAIQNAQDKKLTLSQIYQYVADNFPFYK 179

  Fly   109 DNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMR 173
            .:|.|||||||||||||:||.|||||:..||||:||||||:...|||||:|.|:|:|....:.|.
Zfish   180 KSKAGWQNSIRHNLSLNDCFKKVARDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRADGNAMS 244

  Fly   174 EK-EEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAML 237
            .| |:|:        |||:       |:.::.|...:...:....:|        ....|.:|..
Zfish   245 VKSEDAL--------KLAD-------TSSLMSASQPSLQNSPTSSDP--------KSSPSPSAEH 286

  Fly   238 NSCHDS-LAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHA 301
            :.|..: :..||.:..|             |....|...||   ||.:            ...|.
Zfish   287 SPCFSNFIGNMNSIMSG-------------NAVRSRDGSSA---HLGD------------FTQHG 323

  Fly   302 AAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNG 366
            .:.|..                                                :|||||...|.
Zfish   324 MSGHEI------------------------------------------------SPPSEPGHLNT 340

  Fly   367 QQGTPTHPGHNNNN-SSSVLNHNGVGN 392
            .:.......|||:. .:|:.||..|.|
Zfish   341 NRLNYYSASHNNSGLINSISNHFSVNN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 60/85 (71%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 60/85 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.