DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXD4L4

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_954714.2 Gene:FOXD4L4 / 349334 HGNCID:23762 Length:416 Species:Homo sapiens


Alignment Length:164 Identity:79/164 - (48%)
Similarity:94/164 - (57%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQ 115
            |.||:     |....::..||||||||||.|||.....|::||:||..:|..||||||.....||
Human    94 PRSAA-----ASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQ 153

  Fly   116 NSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIK 180
            ||||||||||:||||:.|:...||||:||:|||.|.:|||||||||||:|||            :
Human   154 NSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFK------------R 206

  Fly   181 RQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAH 214
            .|......|....|        |.|.|.|.|..|
Human   207 HQLTPGAHLPHPFP--------LPAAHAALHNPH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
FOXD4L4NP_954714.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 4/15 (27%)
Forkhead 108..194 CDD:278670 54/85 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.