DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXI3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001129121.1 Gene:FOXI3 / 344167 HGNCID:35123 Length:420 Species:Homo sapiens


Alignment Length:449 Identity:132/449 - (29%)
Similarity:181/449 - (40%) Gaps:159/449 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGYGSASAVAA-------------ASSASAAAAAHY------------AYDQYSRYPYSASAYGL 59
            |.|.:..|.||             ..||:|||||.|            |...:.:.|.:|..:|.
Human    40 ADYAAPPAAAANPYLWLNGPGVGGPPSAAAAAAAAYLGAPPPPPPPGAAAGPFLQPPPAAGTFGC 104

  Fly    60 ----------------GAPHQNKEI--------------VKPPYSYIALIAMAIQNAADKKVTLN 94
                            .||....|:              |:|||||.||||||||:|.::|:||:
Human   105 SQRPFAQPAPAAPASPAAPAGPGELGWLSMASREDLMKMVRPPYSYSALIAMAIQSAPERKLTLS 169

  Fly    95 GIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSF 159
            .|||::.:.||:|:.:|.|||||||||||||:||.||.||:..||||:||||||:...|||||:|
Human   170 HIYQFVADSFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNF 234

  Fly   160 LRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLG 224
            .|:|:|         :.||                    :||...|      |...|.|..:..|
Human   235 RRKRKR---------RSEA--------------------SNGSTVA------AGTSKSEEGLSSG 264

  Fly   225 CLSG-----KEVSHAAMLNSCHD--------SLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHS 276
            ..||     :|.|.:.:|...|.        |.|.    :.||   |..|....:|.:       
Human   265 LGSGVGGKPEEESPSTLLRPSHSPEPPEGTKSTAS----SPGG---PMLTSTPCLNTF------- 315

  Fly   277 AYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSG-HSPTTI 340
                         .:|.....|..:.:...|....||:         |.|||...||| .|||:|
Human   316 -------------FSSLSSLSVSSSVSTQRALPGSRHL---------GIQGAQLPSSGVFSPTSI 358

  Fly   341 STPHGPA-------------HGGWYTPETPPSEPVPHNGQQGTP-THPGHNNNNSSSVL 385
            |......             ...:|:|     .|...:|.|.:| :.|.||.:..:|::
Human   359 SEASADTLQLSNSTSNSTGQRSSYYSP-----FPASTSGGQSSPFSSPFHNFSMVNSLI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)
FOXI3NP_001129121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..122 1/18 (6%)
Forkhead 145..231 CDD:278670 55/85 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..306 24/113 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396 5/36 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.