DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and slp2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster


Alignment Length:314 Identity:114/314 - (36%)
Similarity:147/314 - (46%) Gaps:69/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAPHQNKE-IVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLS 123
            |.|.::|: ..||||||.|||.|||:.:::|::||||||:|||...|||||||||||||||||||
  Fly   169 GKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLS 233

  Fly   124 LNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEK 188
            ||:|||||.|....||||:||.|||.:.::|..||..:.|||  .....|.:..|.||..     
  Fly   234 LNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR--TTAASRSRLAAFKRSL----- 291

  Fly   189 LAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQ-MNHLA- 251
            :..|.|            .:||:...             |:.:::.....|...|:.| .|..| 
  Fly   292 IGPMFP------------GLAAYPQF-------------GQFLTYPPTAPSLLASMYQRYNPFAP 331

  Fly   252 GGGVEHPGFT--VDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMH---------HVHHAAAAH 305
            .||..|||..  :..|.....|:......|    ...:|...||:::         |.|.||||.
  Fly   332 KGGPGHPGLPPGLPGLPGPPGPQGPPGPPP----PPFVAPPTSSELYQRLQYQQLLHQHAAAAAL 392

  Fly   306 HAQQLQRHVA------------HVAH------PLTPGGQGAGGQSSG-HSPTTI 340
            .|.|.|..||            |..|      ||:|||...|..... |.|.|:
  Fly   393 AAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQPLHKPVTV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 59/85 (69%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 58/84 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445525
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.