DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fd19B

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:315 Identity:87/315 - (27%)
Similarity:135/315 - (42%) Gaps:89/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DQNSFTRHYAQTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKP 71
            :::..::|  .:.:.:.|.|:.::.||:.:.||                          |...||
  Fly    23 EESPISKH--NSGSSFSSCSSSSSNSSSDSMAA--------------------------KSNAKP 59

  Fly    72 PYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDK 136
            .::|.|||.|||.::::|::||:||.::|.:.|||||..|..||||||||||||..||:|.|...
  Fly    60 AFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALD 124

  Fly   137 KPGKGSYWTLDPDSYNMFDNGSFLR-RRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTN 200
            .||:|.||.|||.:.::....:..| ||..:::....|.|......|.|           ....:
  Fly   125 DPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRM-----------PYYGH 178

  Fly   201 GILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSL 265
            |.....::.||:|:|   |:||       ...||||                  |:|    ..::
  Fly   179 GHGNGPYIKAHSAYF---PIMD-------HQHHAAM------------------VQH----YQAM 211

  Fly   266 MNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHP 320
            |:.|....|    |:|           .|..|.|....:|..||.:  ..|:..|
  Fly   212 MHRYQMMPH----PHH-----------HQHQHQHQHPHSHFIQQSK--PLHIQEP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 45/85 (53%)
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445526
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.