DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and CHES-1-like

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster


Alignment Length:622 Identity:137/622 - (22%)
Similarity:211/622 - (33%) Gaps:256/622 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GYGSASAVAAASSAS-------------AAAAAHYAYDQYSRYPYSASAYGLG------------ 60
            |.|.|:..:..|.||             .::..|.:..|||.....|:.||.|            
  Fly   614 GGGGANLRSPNSYASYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSN 678

  Fly    61 APHQNKE--------IV----KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQG 113
            .|.:.|.        :|    |||||:.:||.|||:.:.:|.:.:..||.:|::.|||::....|
  Fly   679 TPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNG 743

  Fly   114 WQNSIRHNLSLNECFVKVARDDKKP--GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKE 176
            |:||:|||||||:.||||   :|.|  ||||.|.::|.                 ::::::    
  Fly   744 WKNSVRHNLSLNKSFVKV---EKAPNMGKGSLWRVEPQ-----------------QRQNLI---- 784

  Fly   177 EAIKRQAMM-NEKLAEMKP-LKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNS 239
            :|:.|.... |..:.::.| ||..:.|                                     |
  Fly   785 QALNRSPFFPNSAVDKISPSLKSPSGG-------------------------------------S 812

  Fly   240 CHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAA 304
            .:||      |.|||        ...::...|....:..|      ..|.||.|.....:..|.|
  Fly   813 AYDS------LDGGG--------SGSVSSAQPVAGGAGVP------AAAAVALSTPTKSNGLALA 857

  Fly   305 HHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTP--------------E 355
            :.|.|    ..:.|.|.:|.|.|:|..:.                  :.|              |
  Fly   858 NGASQ----ATNAARPHSPNGGGSGSHAR------------------FDPYLFPNLSKAFRNIRE 900

  Fly   356 TPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGG------------------ 402
            ....:|:..:......:...|||||::|...:|.:|..|.||.|.||                  
  Fly   901 DTVGQPMLQDALDDELSGDYHNNNNNNSGSKYNYMGANGSGGAGSGGVGSNANGASDGINFARLA 965

  Fly   403 ---------------------------------GSSSVLTSSPTSALGFRDMIFEQNQSCQLDTG 434
                                             ||..|:||||:     .|..:....:...|:|
  Fly   966 RDCGADSIDDVHAAAAMLYLKHGPKIYSEPFQNGSGPVITSSPS-----EDHTYSAGGNSNADSG 1025

  Fly   435 SPTGSLQSASPPASASVAAAS--------------AAAAAAVISSHHHHH----------HHH-- 473
            |.| .|.:.:..||.:.|.|.              |::.||..||..:|:          .|.  
  Fly  1026 SST-PLTNGNALASVAQAVAQGQNNQGGAGSDSNCASSDAAYDSSEENHNITPEEMADRQRHRDG 1089

  Fly   474 ----AALSG-NLGQLGQL----------SNLSHYRPH 495
                .:||| ::.:.|.:          |..||..||
  Fly  1090 VDALLSLSGSSIVECGSVATTHYHSNGSSGSSHGSPH 1126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 40/87 (46%)
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/108 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.