DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxj3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:414 Identity:108/414 - (26%)
Similarity:163/414 - (39%) Gaps:105/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SAYGLGAPHQN-----------KEIV-----KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMER 103
            :|:|.|...:|           :|:.     ||||||.:||..||.::..||:||:.|||:|.:.
  Rat    47 NAHGTGISKKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDN 111

  Fly   104 FPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKK 168
            |||||:...||:||||||||||:||:||.|....|||||||.:|.:     .....|..|.:.:.
  Rat   112 FPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTN-----PKEDTLPTRPKKRA 171

  Fly   169 KDVMREK------EEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLS 227
            :.|.|..      .:::..:.:::...:....:..:||                |..|.:.. ..
  Rat   172 RSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTN----------------KVTLYNTD-QD 219

  Fly   228 GKEVSHAAMLNSCHD-SLAQMNHLAGGGV-------EHPGFTVDSLMNVYNPR------------ 272
            |.:...:::.||..| |||.:|..:.|.|       .||.....||.....|:            
  Rat   220 GSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTNHPEPVSQSLTPQQQPQYNLPERDKQLLF 284

  Fly   273 --------------IHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQ----LQRHVAHVAH 319
                          ::.|.:...|::..|.::.|......|.:.:..|:..    ...|....:.
  Rat   285 TEYNFEDLSASFRSLYKSVFEQSLSQQGLMSIPSESSQQSHTSCSYQHSPSSTVTSHPHSNQSSL 349

  Fly   320 PLTPGGQGAGGQSS------GH-------SPTTISTPHG-PAHGGWYTPETPPSEP-------VP 363
            |....|..|.|.:|      .|       ||.|...||| |.|.  ..|:.|.|.|       .|
  Rat   350 PNNHSGLSATGSNSVAQVSLSHPQMHTQPSPHTPHRPHGLPQHP--QRPQHPASHPQQHSQLQPP 412

  Fly   364 HNGQQGTPTHPGHNNNNSSSVLNH 387
            |:.......|..|:.|:....|.|
  Rat   413 HSQHPPPHQHIQHHPNHQHQTLAH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 48/85 (56%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 80/312 (26%)
FH_FOXJ3 77..155 CDD:410826 47/77 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.