DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxe3

DIOPT Version :10

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:102 Identity:66/102 - (64%)
Similarity:86/102 - (84%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||||||||:.:|..:::||..||::|.|||.:|||:.:.|||||||||:||:|||||.|:
Mouse    64 KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPRE 128

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDV 171
            ...||||:||||||.:.:|||||||||||:|||:.::
Mouse   129 PGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAEL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 FH_FOX 69..159 CDD:469596 57/88 (65%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
FH_FOXE 64..152 CDD:410793 56/87 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.