DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxb1a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571360.1 Gene:foxb1a / 30542 ZFINID:ZDB-GENE-990616-47 Length:297 Species:Danio rerio


Alignment Length:390 Identity:117/390 - (30%)
Similarity:169/390 - (43%) Gaps:114/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||:..:|.:.|:.||::||:||||||:|.|.||||:|||||.|:||:|:.|.
Zfish    13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:|||||:|.|.|...:||:||||||||:|||               .|.:|.||..||     
Zfish    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK---------------VMTSEHLAPSKP----- 122

  Fly   200 NGILEAKHMAAHAAHF-KKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVD 263
                      :.|||: ::...:.|..|.    :|...::|.:..::|.:..     :|| |.::
Zfish   123 ----------SDAAHYLQQHAKLRLSALG----THLPQMSSYNLGVSQPSTF-----KHP-FAIE 167

  Fly   264 SLM----NVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPG 324
            :::    .|.......:.||.|    |..|.|...|:              ...:...|.|::. 
Zfish   168 NIIAREYKVPGGLAFSTGYPLH----NQLTTAWPHMY--------------STSMMDSAAPISM- 213

  Fly   325 GQGAGGQSSGHSPTTISTPHGPAHGGWYTPETP-PSEPVPHNGQQGTPTH-PGHNNNNSSSVLNH 387
                  .||.:|...:.. ....|||...|..| |.:|.|    ...|.| |...:|:..|:   
Zfish   214 ------TSSDYSAYGVPI-KSLCHGGQTLPAIPVPIKPTP----AALPHHIPAFLSNSPQSL--- 264

  Fly   388 NGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPASASVA 452
                                   ||||         .|..:.|....:|:.:|  ..|....|||
Zfish   265 -----------------------SPTS---------PQTATSQSSPATPSETL--TGPATLQSVA 295

  Fly   453  452
            Zfish   296  295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/85 (60%)
foxb1aNP_571360.1 FH 13..101 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.