DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxa

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571357.2 Gene:foxa / 30539 ZFINID:ZDB-GENE-990415-76 Length:355 Species:Danio rerio


Alignment Length:371 Identity:115/371 - (30%)
Similarity:152/371 - (40%) Gaps:88/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HYAQTAAGYGSASAVAAASSASAA-----AAAHYAYDQYS----RYPYSASAYGLGAPHQNKEIV 69
            ||........||.||......|.|     |....||.:.:    .:....|.|.....|     .
Zfish    41 HYQSYGVQCDSAPAVNPGRLGSPAGLLPPANPPKAYAEINSSEPEFQELKSVYRRTLSH-----A 100

  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:||.||||.:..|::|||.||.:|.:.|||||.|:|.|||||||:||.|:|||:|.|.
Zfish   101 KPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRS 165

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFK-KKDVMREKEEAIKRQAMMNEKLAEMKPLKLM 198
            ...|||||||.|.|||.|||:||.::||::||| :|.....|....:...:..:|..|:|.:...
Zfish   166 PDSPGKGSYWALHPDSGNMFENGCYMRRQKRFKCQKSTSTGKNSEGEDVKVEKKKKKEIKSVSSC 230

  Fly   199 TNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVD 263
                              |.|..|....|...||:|      :...|..:||             
Zfish   231 ------------------KSPTSDATKQSSTTVSYA------NTKPASPSHL------------- 258

  Fly   264 SLMNVYNPRIHHSAYP-------YHL----------NEDNLATVASSQMHHVHHAAAAHHAQQLQ 311
                  ||  .|:.:|       .||          .|.:|....|||    |...:.......|
Zfish   259 ------NP--SHTLFPTQPPEISTHLPSLSVPFPASMETSLHCEPSSQ----HQPISVPRLVDFQ 311

  Fly   312 RHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETP 357
            .....|::||.       .||:.|:.....|.....:.|:....||
Zfish   312 YCETPVSYPLY-------CQSNSHANFPSYTTDSVYYPGFSMCSTP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxaNP_571357.2 FH 101..189 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.