DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxk2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:411 Identity:111/411 - (27%)
Similarity:150/411 - (36%) Gaps:122/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GSASAV-AAASSASAAAAAHYAYDQY-----------SRYPYSASAYGLGAPHQNKEIVKPPYSY 75
            |:.||. :..||...|.::.|...:.           |:......|.|..:|   |:..||||||
  Rat   193 GTISAANSCPSSPRGAGSSGYKMGRVIPSDLNLMADNSQPENEKEASGGDSP---KDDSKPPYSY 254

  Fly    76 IALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGK 140
            ..||..||..|.||::||||||.:|.:.:||||...:|||||||||||||..|:||.|..::|||
  Rat   255 AQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGK 319

  Fly   141 GSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEA 205
            ||:|.:||.|.:.....:|.:||.|                                   |:   
  Rat   320 GSFWRIDPASESKLVEQAFRKRRPR-----------------------------------GV--- 346

  Fly   206 KHMAAHAAHFKKEPLM--DLGCLSGKEV----SHAAMLNSCHDSLAQM-NHLAGGG-----VEHP 258
                         |..  .||.||.:..    :||.:| |.|.|.||. ..|:..|     ...|
  Rat   347 -------------PCFRTPLGPLSSRSAPASPNHAGVL-SAHSSGAQTPESLSREGSPAPLEPEP 397

  Fly   259 GFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQM--------HHVHHAAAAHHAQQLQRHVA 315
            |.:...|..:...|...||....|:...:......|:        :.|........:|.......
  Rat   398 GASQPKLAVIQEARFAQSAPGSPLSSQPVLITVQRQLPPAIKPVTYTVATPVTTPTSQPPVVQTV 462

  Fly   316 HVAHPL-----------------TPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVP 363
            ||.|.:                 |..||....|::..:|.|     .|...|.:.......||||
  Rat   463 HVVHQIPAVAVTSVAGLAPANTYTVAGQAVVTQAAVLAPKT-----EPQENGDHREVRVKVEPVP 522

  Fly   364 H-------------NGQQGTP 371
            .             ...||||
  Rat   523 AISPATLGAASRIIQTSQGTP 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 50/85 (59%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017
Forkhead 249..335 CDD:278670 50/85 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.