DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxg1a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571142.1 Gene:foxg1a / 30274 ZFINID:ZDB-GENE-990415-267 Length:420 Species:Danio rerio


Alignment Length:346 Identity:110/346 - (31%)
Similarity:155/346 - (44%) Gaps:63/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECF 128
            :|.:..|||:||.|||.|||:.:.:|::||||||::||:.|||||:||||||||||||||||:||
Zfish   107 KNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCF 171

  Fly   129 VKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMK 193
            |||.|....||||:||.|||.|.::|..|:..:.||                |......|||..:
Zfish   172 VKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRR----------------RSTTSRAKLAFKR 220

  Fly   194 PLKLMTNGILEAKHMAAHAAHFKKEPLMDL------GCLSGKEVSHAAMLNSCHDSLAQMNHLAG 252
            ..:|.:.|:.....  |.:.::...|.:.|      ..||....|.|...:....|.....:..|
Zfish   221 GARLTSTGLTFMDR--AGSLYWPMSPFLSLHHPRASSALSYNGASSAYPSHPMSYSTMLTQNSLG 283

  Fly   253 GGVEHP---GFTVDSLMNVYNPRIHHSAYPYHLNEDNLA-------TVASSQMHHVHHAAAAHHA 307
            .....|   |.:||.|:|...|...|     ||....||       :|..|..:.::..:....|
Zfish   284 NNHSFPASNGLSVDRLVNGEIPYATH-----HLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLA 343

  Fly   308 QQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVP--------- 363
            .|......||.||          ..:..|.|::|:....:.    :|:|..|.|..         
Zfish   344 GQTSYFFPHVPHP----------SMTSQSSTSMSSRAASSS----SPQTASSLPCDSLRPSLSSF 394

  Fly   364 HNG-QQGTPTHPGHNNNNSSS 383
            .:| ..|...:..|.|..|:|
Zfish   395 SSGLSSGLSDYFTHQNQGSTS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/85 (68%)
foxg1aNP_571142.1 FH 113..201 CDD:214627 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.