DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxa2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571024.1 Gene:foxa2 / 30126 ZFINID:ZDB-GENE-980526-404 Length:409 Species:Danio rerio


Alignment Length:376 Identity:124/376 - (32%)
Similarity:171/376 - (45%) Gaps:89/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGYG------SASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKE---------IV 69
            ||.|      ||:.....|..:|.|.:..|...||.....:..||....:::::         ..
Zfish    86 AGMGAGMTGMSAALSPTMSPMAAQAPSMNALTSYSNMNAMSPMYGQSNINRSRDPKTYRRSYTHA 150

  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:||.||||.:..|.:||:.|||:||:.||:||.|:|.|||||||:||.|:||:||.|.
Zfish   151 KPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRS 215

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFK-----KKDVMREKEEAIKRQAMMNEKLAEMKP 194
            ..||||||:|||.|||.|||:||.:|||::|||     .||..|:..|.....:..:        
Zfish   216 PDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCDKKLSKDPSRKTSEGGSNSSSES-------- 272

  Fly   195 LKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAA--------MLNSCHDSLAQMNHLA 251
                .|| .|:.|..:.:...|:. |.|:....|....|||        :|...|..||...|| 
Zfish   273 ----CNG-NESPHSNSSSNELKRS-LSDMKSGQGLSPDHAASPTSQAQHLLAQHHSVLAHEGHL- 330

  Fly   252 GGGVEHPGFTVDSLMNVYNPRIHHS-AYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRH-- 313
                              .|..|:| .:|:.:|  ||  ::|.|.         ||...|:.:  
Zfish   331 ------------------KPEHHYSFNHPFSIN--NL--MSSEQQ---------HHKMDLKTYEQ 364

  Fly   314 VAHVAHPLTPGGQGAGGQSSGH--SPTTISTPHGPAHGGWYTPETPPSEPV 362
            |.|..:    |...||..|.|.  |...:.:|....:.|.|      |.|:
Zfish   365 VMHYGY----GSPMAGTLSMGSMASKAGLDSPDTSYYQGVY------SRPI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
foxa2NP_571024.1 Forkhead_N 18..150 CDD:254796 13/63 (21%)
FH 151..239 CDD:214627 58/87 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..315 15/78 (19%)
HNF_C 340..398 CDD:286443 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.