DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxh1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:407 Identity:95/407 - (23%)
Similarity:135/407 - (33%) Gaps:152/407 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||:|:|:||:.|:.              :...||::||:.:||::|||||||.|.||.||.:|
  Rat    93 KPPYTYLAMIALIIRQ--------------VQAVFPFFRDDYEGWKDSIRHNLSSNRCFRKVPKD 143

  Fly   135 DKKP-GKGSYWTLD----PDSYNMFDNGSFLRR------RRRFKKKDVMREKEEAIKRQAMMNEK 188
            ..|| .||::|.:|    |.......|.:..||      .|.|.|                    
  Rat   144 PAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAK-------------------- 188

  Fly   189 LAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGG 253
              ::.|..|         |...:.......|       |.::.|..::|..              
  Rat   189 --DLSPYVL---------HGQPYRPPSPPPP-------SREDFSIKSLLGD-------------- 221

  Fly   254 GVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVA 318
                ||                              .||:...|...|..:..||         |
  Rat   222 ----PG------------------------------KASTWPQHPRLAGQSTPAQ---------A 243

  Fly   319 HPLTPGGQGAGGQSSGHSPTTI----STPHGPAHGGWYTPETPPSE---PVPHNGQQGT-PTHPG 375
            ..|:.|.:|.|...|..|...:    |.|......|    ||...|   |.|.:..||: |.|..
  Rat   244 STLSKGEEGIGAGPSNVSDKPLWPLSSLPRPTRIEG----ETSQGEVIRPSPVSSDQGSWPLHLL 304

  Fly   376 HNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTG-- 438
            .::::|.              |....|..:|:....|||.|    .|:..|....|.|..||.  
  Rat   305 QDSSDSM--------------GMSRRGSRASLWGQLPTSYL----PIYTPNVVMPLATLPPTSCP 351

  Fly   439 SLQSASPPASASVAAAS 455
            ...|::.||..||...|
  Rat   352 RCPSSASPAYWSVGTES 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 35/90 (39%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.