DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxd3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:471 Identity:147/471 - (31%)
Similarity:197/471 - (41%) Gaps:119/471 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AAAHYAYDQYSRYPYSASAYG----LGAPH----------------------------QNK---E 67
            |:||:...|.......:.|.|    .|||.                            .||   .
  Rat    64 ASAHHGQSQPQALALPSEATGPGNDTGAPEADGCKGGEDAVTGGGGPGAGGGATGGLTPNKPKNS 128

  Fly    68 IVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVA 132
            :|||||||||||.|||..:..||:||:||.::|..||||||:....||||||||||||:||||:.
  Rat   129 LVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIP 193

  Fly   133 RDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQ-AMMNEKLAEMKPLK 196
            |:...||||:||||||.|.:|||||||||||:|||     |.::|.::.| |:|.:...      
  Rat   194 REPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFK-----RHQQEHLREQTALMMQSFG------ 247

  Fly   197 LMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFT 261
              ...:..|.....:...:...|....|..|....:.||              .|...:::| :.
  Rat   248 --AYSLAAAASAGPYGRPYGLHPAAAAGAYSHPAAAAAA--------------AAAAALQYP-YA 295

  Fly   262 VDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQ-----QLQRHVAHVAHPL 321
            :..:..|..|.:              ..:.|.::   ...|||..:|     |||.:        
  Rat   296 LPPVAPVLPPAV--------------PLLPSGEL---GRKAAAFGSQLGPSLQLQLN-------- 335

  Fly   322 TPGGQGAGGQSSGHSPTT--ISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSV 384
            |.|...|...::|.:.||  |.:          .|...||..:.:....| |..||      ||.
  Rat   336 TLGAAAAAAGTAGAAGTTSLIKS----------EPSARPSFSIENIIGAG-PAAPG------SSA 383

  Fly   385 LNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTG--SPTGSL----QSA 443
            ......|..|||||.|||||:......|.:......|...|..|....|.  :|..|:    |..
  Rat   384 GGGGSAGGAGGGGGSGGGGSAQSFLRPPGTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFL 448

  Fly   444 SPPASASVAAASAAAA 459
            .|.|||:.|||:|..|
  Rat   449 QPAASAAAAAAAAVQA 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 66/95 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.