DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxi1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:369 Identity:113/369 - (30%)
Similarity:158/369 - (42%) Gaps:122/369 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYG------------LGAPHQNK--EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIM 101
            |:...|||            |..|.|.:  ::|:|||||.|||||||..|.|:::||:.||||:.
  Rat    84 PFLPQAYGMQRQLLPSELGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVA 148

  Fly   102 ERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRF 166
            :.||:|..:|.|||||||||||||:||.||.||:..||||:||||||:...|||||:|.|:|:| 
  Rat   149 DNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR- 212

  Fly   167 KKKD-------VMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLG 224
             |.|       :..||.|         .:|....|.......:|:.......::..:|.      
  Rat   213 -KSDASSSTGSLASEKTE---------NRLLSSSPKPTEPQEVLDTASPDTTSSSPEKR------ 261

  Fly   225 CLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLAT 289
              |....|....||         |.|:         |:.:.:|..||....:|.|          
  Rat   262 --SSPAPSGTPCLN---------NFLS---------TMTAYVNGTNPISRSAATP---------- 296

  Fly   290 VASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSS----GHSPTTISTPHGPAHGG 350
                                          .|:|......||:|    .::|.|..:.||  :||
  Rat   297 ------------------------------GLSPEPVDKMGQNSLNFNSYTPLTNLSSHG--NGG 329

  Fly   351 -WYTPETPPSEPVPHNG--------QQGTPTHPGHNNNNSSSVL 385
             |       :.|||.|.        .|.:|..  :|:.|::|:|
  Rat   330 EW-------ANPVPTNALGYGGPVFNQFSPHF--YNSINTNSIL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.