DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXD3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_036315.1 Gene:FOXD3 / 27022 HGNCID:3804 Length:478 Species:Homo sapiens


Alignment Length:440 Identity:151/440 - (34%)
Similarity:184/440 - (41%) Gaps:123/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNS 117
            |.||.||........:|||||||||||.|||..:..||:||:||.::|..||||||:....||||
Human   124 SGSAGGLAPSKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNS 188

  Fly   118 IRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQ 182
            ||||||||:||||:.|:...||||:||||||.|.:|||||||||||:|||     |.::|.::.|
Human   189 IRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFK-----RHQQEHLREQ 248

  Fly   183 -AMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQ 246
             |:|                      |.:..|:                            ||| 
Human   249 TALM----------------------MQSFGAY----------------------------SLA- 262

  Fly   247 MNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQ 311
                |..|...|                 ...||.|:    ...|:....|...||||..|..||
Human   263 ----AAAGAAGP-----------------YGRPYGLH----PAAAAGAYSHPAAAAAAAAAAALQ 302

  Fly   312 -----RHVAHV---AHPLTPGGQ------------GAGGQSSGHSPTTISTPHGPAHGGWYTPET 356
                 ..||.|   |.||.|.|:            |.|.|...:|....:...|.|.....|...
Human   303 YPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGAAAAAAGTAGAAGTTASL 367

  Fly   357 PPSEPVP------HNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSA 415
            ..|||..      .|...|.|..||     .|:|    |.|..||.||.|||.::......|.:.
Human   368 IKSEPSARPSFSIENIIGGGPAAPG-----GSAV----GAGVAGGTGGSGGGSTAQSFLRPPGTV 423

  Fly   416 LGFRDMIFEQNQSCQLDTG--SPTGSL----QSASPPASASVAAASAAAA 459
            .....|...|..|....|.  :|..|:    |...|.|||:.|||:||.|
Human   424 QSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQA 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
FOXD3NP_036315.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136 5/11 (45%)
Forkhead 141..227 CDD:278670 56/85 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.