DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fkh2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_596764.1 Gene:fkh2 / 2539703 PomBaseID:SPBC16G5.15c Length:642 Species:Schizosaccharomyces pombe


Alignment Length:472 Identity:113/472 - (23%)
Similarity:163/472 - (34%) Gaps:147/472 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSI 118
            |:.||     .||   ||||||..:||.||.::::..:||:.||.:|...:||||..|.||||||
pombe   215 AAEYG-----DNK---KPPYSYSVMIAQAILSSSECMMTLSNIYSWISTHYPYYRTTKSGWQNSI 271

  Fly   119 RHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQA 183
            |||||||:.|.||.|...:.|||..|::.|:.     ...|:.:.|:..:|   |.....:...|
pombe   272 RHNLSLNKAFRKVPRKSGEQGKGMKWSIVPEF-----REEFIAKTRKTPRK---RSPSSPVPLLA 328

  Fly   184 MMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMN 248
            ...|....: |:.::.    :.|..:..||    ||              |:...|..|......
pombe   329 KKREGSPSL-PIPILP----KMKDTSIPAA----EP--------------ASSTTSARDQTPSTP 370

  Fly   249 HLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVH-HAAAAHHAQQLQR 312
            ...|..........:..|..|....|               .|.|.:...| :|..|:.|.|.::
pombe   371 KDVGSPSTAETSAEEKQMETYKTPTH---------------AALSDIISTHDYALDANSASQTKK 420

  Fly   313 HVAHVAHPLTPGGQGAGGQSSGHS--PTT----------ISTPHGPAHGGWYTPETPPSEPV-PH 364
                          .|.|...|.|  ||:          :..||.....|.|...:|...|| .|
pombe   421 --------------AAFGSPIGSSTYPTSSPAPFWKYVAVPNPHDWPQVGSYDTISPYRNPVNSH 471

  Fly   365 ---------------------------NGQQG------------------TPTHPGHNNNNSSSV 384
                                       ||.:|                  :||....|:|:.||.
pombe   472 LIYSQIQQSSPKKIDEQLHDLQGVDLVNGFEGISSWRESMVNKLRSSVSDSPTMNLANSNSKSSP 536

  Fly   385 LNHNGVGN-GGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQ--LDTG------------ 434
            :....|.. .............|.:::|||.    :....|.||:.:  ||..            
pombe   537 VAVQRVSTLPQASANKQAKEMESKMSNSPTQ----KSKTEENNQAVRAILDASATMEKQYDLHRL 597

  Fly   435 -SPTGSLQSASPPASAS 450
             :||...:|||.|..|:
pombe   598 PTPTSQTESASVPQIAN 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 42/85 (49%)
fkh2NP_596764.1 COG5025 6..622 CDD:227358 113/472 (24%)
FHA 81..185 CDD:238017
Forkhead 223..308 CDD:278670 42/89 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.