DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxa3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:240 Identity:94/240 - (39%)
Similarity:126/240 - (52%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SASAYGLGAPH--QNKEI----------VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFP 105
            |||.||...|.  ..||:          .|||||||:||.||||.|..|.:||:.|||:||:.||
  Rat    97 SASGYGAPGPGLVHGKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFP 161

  Fly   106 YYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKD 170
            |||:|:|.|||||||:||.|:|||||||...||||||||.|.|.|.|||:||.:|||::|||.::
  Rat   162 YYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEE 226

  Fly   171 VMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAA 235
            ..::...|  ..|..|..:..      .|:....|.......|..:..|..:....||::|... 
  Rat   227 KAKKGNSA--TSATRNGTVGS------ATSATTTAATAVTSPAQPQPTPPSEPEAQSGEDVGGL- 282

  Fly   236 MLNSCHDSLAQMNHLAGGGVEHPG-------------FTVDSLMN 267
               .|....:...:..  |:|.||             |::::||:
  Rat   283 ---DCASPPSSAPYFT--GLELPGELKLDAPYNFNHPFSINNLMS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 60/85 (71%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 68/100 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.