DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxa1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_038967720.1 Gene:Foxa1 / 25098 RGDID:2807 Length:475 Species:Rattus norvegicus


Alignment Length:544 Identity:161/544 - (29%)
Similarity:194/544 - (35%) Gaps:214/544 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTLFSDQN----SFTRHYAQTAAGYG-SASAVAAASSASAAA---------------------- 38
            |:|:.:..|    ||...||....|.| |..|||.....||.|                      
  Rat    50 MNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGAALSPGGMG 114

  Fly    39 --AAHYAYDQYSRYPYSAS--------AY---GLGA----------------PHQNKEIVKPPYS 74
              .|..|.......||:|:        ||   .||.                ||     .|||||
  Rat   115 SMGAQPAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPH-----AKPPYS 174

  Fly    75 YIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPG 139
            ||:||.||||.|..|.:||:.|||:||:.|||||.|:|.|||||||:||.|:|||||||...|||
  Rat   175 YISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPG 239

  Fly   140 KGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILE 204
            |||||||.|||.|||:||.:|||::|||                                     
  Rat   240 KGSYWTLHPDSGNMFENGCYLRRQKRFK------------------------------------- 267

  Fly   205 AKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVY 269
                      .:|:|    |...|.                     .|||.:.............
  Rat   268 ----------CEKQP----GAGGGS---------------------GGGGSKGVPENRKDPSGPV 297

  Fly   270 NPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVA--HVAHPLT---PGGQGAG 329
            ||.                  |.|.:|...|..|:    ||:...|  ..|.|.|   .|....|
  Rat   298 NPS------------------AESPIHRGVHGKAS----QLEGAPAPGPAASPQTLDHSGATATG 340

  Fly   330 GQSSGHSPTTISTP---HGPAHGGWYTPETPPSEP----VPHNGQ---QGTP----THP-GHNNN 379
            |.|...||.:.|.|   .||.    .....|||.|    .||..|   :|.|    .|| ..||.
  Rat   341 GASELKSPASSSAPPISSGPG----ALASVPPSHPAHGLAPHESQLHLKGDPHYSFNHPFSINNL 401

  Fly   380 NSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSAS 444
            .|||...|.                           |.|:    ...|:.|.   ||.|:...||
  Rat   402 MSSSEQQHK---------------------------LDFK----AYEQALQY---SPYGATLPAS 432

  Fly   445 -PPASASVAAASAAAAAAVISSHH 467
             |..|||||..|....:|:..:::
  Rat   433 LPLGSASVATRSPIEPSALEPAYY 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 62/85 (73%)
Foxa1XP_038967720.1 Forkhead_N 17..169 CDD:369872 27/123 (22%)
FH_FOXA1 157..268 CDD:410812 72/162 (44%)
HNF_C 394..457 CDD:401339 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.