DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXE1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_004464.2 Gene:FOXE1 / 2304 HGNCID:3806 Length:373 Species:Homo sapiens


Alignment Length:522 Identity:130/522 - (24%)
Similarity:182/522 - (34%) Gaps:237/522 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIV--KPPYSYIALI 79
            :||||.|                          .|..|:..|.|...:.:.:.  ||||||||||
Human    24 ETAAGAG--------------------------VPGEATGRGAGGRRRKRPLQRGKPPYSYIALI 62

  Fly    80 AMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYW 144
            ||||.:|.::::||.|||::|.||||:||||.:.|||||||||:||:||:|:.|:..:||||:||
Human    63 AMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYW 127

  Fly   145 TLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMA 209
            .|||::.:||::|||||||:|||:.|:                                      
Human   128 ALDPNAEDMFESGSFLRRRKRFKRSDL-------------------------------------- 154

  Fly   210 AHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIH 274
                                                                             
Human   155 ----------------------------------------------------------------- 154

  Fly   275 HSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTT 339
             |.||.::::...|..|         ||||..|..:.......|.|..||...|     |::|.:
Human   155 -STYPAYMHDAAAAAAA---------AAAAAAAAAIFPGAVPAARPPYPGAVYA-----GYAPPS 204

  Fly   340 ISTP---------HGPAHGGWYTPETPPSE---PVPHNGQQG---------------------TP 371
            ::.|         .||.......||.|.|.   |.| :|..|                     |.
Human   205 LAAPPPVYYPAASPGPCRVFGLVPERPLSPELGPAP-SGPGGSCAFASAGAPATTTGYQPAGCTG 268

  Fly   372 THPGHNNNNSSSVLNHNGVGNGGGG------------------GGGGGGGSSSVLTSSPTS---- 414
            ..|.:.:..:::....:|....|.|                  ||..||..::|.....||    
Human   269 ARPANPSAYAAAYAGPDGAYPQGAGSAIFAAAGRLAGPASPPAGGSSGGVETTVDFYGRTSPGQF 333

  Fly   415 -ALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPASASVAAASAAAAAAVISSHHHHHHHHAALSG 478
             |||          :|.    :|.|.|..||..|                    :|..|.||..|
Human   334 GALG----------ACY----NPGGQLGGASAGA--------------------YHARHAAAYPG 364

  Fly   479 NL 480
            .:
Human   365 GI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)
FOXE1NP_004464.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..51 9/52 (17%)
FH 53..141 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.