DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXL1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:499 Identity:138/499 - (27%)
Similarity:195/499 - (39%) Gaps:196/499 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASAAAAAHYAY-DQYSRYPYS-ASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGI 96
            |.||:...|.| .:....|.: |.|..|.|..:.:...|||||||||||||||:|.:::||||||
Human    11 ALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRVTLNGI 75

  Fly    97 YQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLR 161
            ||:||:|||:|.||:||||||||||||||:|||||.|:..:|||||||||||...:||:||::.|
Human    76 YQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRR 140

  Fly   162 RRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCL 226
            |:|:.|...   ...||.:.:|..:::.||.:|         ||                     
Human   141 RKRKPKPGP---GAPEAKRPRAETHQRSAEAQP---------EA--------------------- 172

  Fly   227 SGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVA 291
                                                                             
Human   173 ----------------------------------------------------------------- 172

  Fly   292 SSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTI-STPHGPAHGGWYTPE 355
                                             |.||||  ||.:.:.: :.|.||         
Human   173 ---------------------------------GSGAGG--SGPAISRLQAAPAGP--------- 193

  Fly   356 TP----PSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSAL 416
            :|    ||.|.|.: ..||.: |..:..:::.......||.....|.|.|........|||.|: 
Human   194 SPLLDGPSPPAPLH-WPGTAS-PNEDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSS- 255

  Fly   417 GFRDMIFEQNQSCQLDTGSPTGSLQSASPPA----------------SASVAAASAAA-----AA 460
                   ::::|..:|  |.....|...||:                .||:.|||::.     |:
Human   256 -------DKSKSFSID--SILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNAS 311

  Fly   461 AVISSHHHHHHHHAALSGNLGQLGQLSNLSHYRPHVG----HYQ 500
            .::..|         :.|...||| :..||::...|.    |:|
Human   312 LMLDPH---------VQGGFYQLG-IPFLSYFPLQVPDTVLHFQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 65/85 (76%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 66/87 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 46/306 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.