DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXK1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001032242.1 Gene:FOXK1 / 221937 HGNCID:23480 Length:733 Species:Homo sapiens


Alignment Length:520 Identity:124/520 - (23%)
Similarity:192/520 - (36%) Gaps:165/520 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GYGSAS-----AVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIA 80
            |.||:|     .|.:....:|..||..|.:|      .|...|..:|   |:..|||:||..||.
Human   260 GAGSSSYRFVQNVTSDLQLAAEFAAKAASEQ------QADTSGGDSP---KDESKPPFSYAQLIV 315

  Fly    81 MAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWT 145
            .||.:|.|:::||:|||.:|.:.:||||...:|||||||||||||..|:||.|..::|||||:|.
Human   316 QAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWR 380

  Fly   146 LDPDSYNMFDNGSFLRRRRR---------------------------------FKKKDVMREKEE 177
            :||.|.......:|.:||:|                                 .:..:.:..:..
Human   381 IDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGLQTPECLSREGS 445

  Fly   178 AIKRQAMMNEKLAEM--------------------------------KPLKLMTNGILEAKHMAA 210
            .|........|||.:                                ||:..|...|:.::..|.
Human   446 PIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAG 510

  Fly   211 HAAH-FKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMN-----VY 269
            ||.| .::.|.:.:    .:.|:.:|  ||.:..:......|||..:..|..|..|.:     ..
Human   511 HAIHVVQQAPTVTM----VRVVTTSA--NSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEE 569

  Fly   270 NPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSG 334
            .|.|..:..|   ....:....:|||           |..:..|...:..|.|            
Human   570 KPTIAFATIP---AAGGVIQTVASQM-----------APGVPGHTVTILQPAT------------ 608

  Fly   335 HSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGG 399
              |.|:...|.|...            |..||:...||       ||.:                
Human   609 --PVTLGQHHLPVRA------------VTQNGKHAVPT-------NSLA---------------- 636

  Fly   400 GGGGSSSVLTSS----PTSALGFRDMIFEQNQSCQLDTGSPTGSL--QSASPPASASVAAASAAA 458
               |::..|||.    .|.|.....::.  .:.|::....|..::  .:.:.||:|:.|:|||::
Human   637 ---GNAYALTSPLQLLATQASSSAPVVV--TRVCEVGPKEPAAAVAATATTTPATATTASASASS 696

  Fly   459  458
            Human   697  696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 47/85 (55%)
FOXK1NP_001032242.1 Interaction with SIN3A and SIN3B. /evidence=ECO:0000250|UniProtKB:P42128 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..79
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000250|UniProtKB:P42128 95..420 65/168 (39%)
FHA <102..204 CDD:224630
FHA 110..203 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..306 6/27 (22%)
Forkhead 305..391 CDD:278670 47/85 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436 0/22 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..733 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.