DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fkh-4

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_510238.2 Gene:fkh-4 / 181466 WormBaseID:WBGene00001436 Length:421 Species:Caenorhabditis elegans


Alignment Length:123 Identity:37/123 - (30%)
Similarity:58/123 - (47%) Gaps:30/123 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKV 131
            ::.:||.||:||.|:|.:||.|.|:|..|:|.:::..:.|||...:.|:||:||.||..|.|   
 Worm   115 DLRRPPISYVALCALACRNAPDMKITPAGVYAFVLHHWRYYRYANENWKNSVRHQLSSKEHF--- 176

  Fly   132 ARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKL 189
              |::        |..||..|                 ..:|.|...:|...|:.:.|
 Worm   177 --DEE--------TFQPDPSN-----------------PTVRRKFYIVKNPNMIRQNL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 32/85 (38%)
fkh-4NP_510238.2 FH 118..206 CDD:214627 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.