DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fkh-9

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001024760.1 Gene:fkh-9 / 180670 WormBaseID:WBGene00001441 Length:300 Species:Caenorhabditis elegans


Alignment Length:114 Identity:48/114 - (42%)
Similarity:63/114 - (55%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYY--RDNKQGWQNSIRHNLSLNECFVKV- 131
            :|..||..||..||..:.:|::.||.|||.|....|||  |.::.||||||||||||::||||: 
 Worm    66 RPSLSYKDLIIEAIDRSPEKRLKLNEIYQVIRLLHPYYRHRPDQWGWQNSIRHNLSLHDCFVKLP 130

  Fly   132 ARDDKKPG-KGSYWTLDPDSYNMFDNGSFLRRRRR------FKKKDVMR 173
            .:.....| .|.:||:.|:    ..:...||||.|      .||.|..|
 Worm   131 LKQTSASGVVGHFWTVVPE----LSDKQTLRRRNRQQPRALAKKSDAGR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 39/89 (44%)
fkh-9NP_001024760.1 FH 66..153 CDD:214627 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.