DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and pha-4

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001041114.1 Gene:pha-4 / 180357 WormBaseID:WBGene00004013 Length:506 Species:Caenorhabditis elegans


Alignment Length:339 Identity:113/339 - (33%)
Similarity:159/339 - (46%) Gaps:80/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQTAA---GYGSASAVAAASS--ASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIV------ 69
            |.|||   ...|||||...|:  :|:..||..|...||..   :...|.....|..|.|      
 Worm   167 ATTAAASVATSSASAVIGRSNGRSSSTVAASPADRSYSGV---SGGQGQELTIQEFETVTEKIRR 228

  Fly    70 -------KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNEC 127
                   |||||||:||.||||.:..:::||:.||.:||:.||||::|:|.|||||||:||.|:|
 Worm   229 HGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDC 293

  Fly   128 FVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRF--KKKDVMREKEEAIKRQAMMNEKLA 190
            ||||||...||||||:|||.....|||:||.:|||::||  |:::..|:|..|..:|....:.:.
 Worm   294 FVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNANSQQLHQQQHIP 358

  Fly   191 EMK-----PLKLMTNGILEAKHMAAHAAHFK--KEPL----------MDLGCL--SG--KEVSHA 234
            :|:     |..:.|...|.|..:....:..|  ||.|          .:||.:  ||  ..|:|:
 Worm   359 KMEIKEEDPTSITTTSSLGAYSLIPQISTKKEIKEELKAVQDATAAAANLGLIDPSGTPSAVNHS 423

  Fly   235 ------AMLNSCHDSLAQM----------------------------NHLAGGGVEHPGFTVDSL 265
                  :.:.:...:.|||                            |.|......:||  :|..
 Worm   424 QPTSVISSVGTLGTTQAQMTLNGQYASPYLYSSDFATILPQSQNFLNNTLYNTTSSYPG--IDYT 486

  Fly   266 MNVYNPRIHHSAYP 279
            ..||...::.|..|
 Worm   487 NGVYQNTLYSSTNP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
pha-4NP_001041114.1 FH 236..324 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.