DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and pes-1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:160 Identity:56/160 - (35%)
Similarity:83/160 - (51%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SAVAAASSASAAAAAHYAYDQYSRY------PYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQ 84
            |:.:::.|.|.|::.|...:...:.      |.|:|.        .....:|.|||.||||||||
 Worm    51 SSTSSSCSVSPASSFHTRSESVGQQQSGRNSPVSSST--------ESPTKRPKYSYNALIAMAIQ 107

  Fly    85 NAADKKVTLNGIYQYIMERFPYYRDNKQ-GWQNSIRHNLSLNECFVKVARDDKKPGKGSYWT--- 145
            ::..|.:.::.||:||...|.||::.|. .||||:||||||::.|.||...|   ||||||.   
 Worm   108 SSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNSVRHNLSLHKEFRKVRTLD---GKGSYWAMTA 169

  Fly   146 -LDPDSYNMFDNGSFLRRRRRFKKKDVMRE 174
             |..|.|...:.|...|::.:..|...|::
 Worm   170 DLGTDVYISNNCGKLRRQKSKVAKFPPMQQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 44/90 (49%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 41/77 (53%)
rad23 <203..>240 CDD:273167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.