DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and unc-130

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:144 Identity:75/144 - (52%)
Similarity:97/144 - (67%) Gaps:8/144 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADK 89
            :::.||.||:..|.......|..||...|.        |:.....||||||||||||:|.|:.:|
 Worm    90 STSSAADSSSDDAKDDDDDDDSTSRKSMSG--------HRKSSHAKPPYSYIALIAMSILNSPEK 146

  Fly    90 KVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMF 154
            |:||:.|.::|:.:|.||::....||||||||||||:|||||||....||||:||.|||:..:||
 Worm   147 KLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMF 211

  Fly   155 DNGSFLRRRRRFKK 168
            |||||||||:|:||
 Worm   212 DNGSFLRRRKRYKK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 53/85 (62%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 65/100 (65%)
Forkhead 127..212 CDD:365978 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.