DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fkh-8

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:104 Identity:43/104 - (41%)
Similarity:60/104 - (57%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNK-QGWQNSIRHNLSLNECFVKVAR 133
            ||||||..||.:||::..|||.||..||.:|...|.:||:|: ..|:||||||||||:.|.::.:
 Worm    74 KPPYSYSQLIRLAIEDTPDKKCTLAEIYSFIAHNFQFYRENRNSSWKNSIRHNLSLNKQFSRIEK 138

  Fly   134 DD--------------KKPG--KGSYWTLDPDSYNMFDN 156
            .|              |||.  |||...::|...:::.|
 Worm   139 TDGDRRGWWVCVDPPAKKPRILKGSPVRVNPIYEHLYHN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 42/102 (41%)
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 43/104 (41%)
FH 74..156 CDD:214627 35/81 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.