DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxe3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:164 Identity:76/164 - (46%)
Similarity:101/164 - (61%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AHYAYDQYSRYPYSASAYGLGAP--------HQNKEIV------------------------KPP 72
            ||.|:..:...| |.|..|...|        .:.:|:|                        |||
  Rat     3 AHVAFSGFPTLP-SVSPSGPQPPSLAGDEPGREPEEVVGGGDSEPPAAPGPGRRRRRPLQRGKPP 66

  Fly    73 YSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKK 137
            ||||||||||:.:|..:::||..||::|.|||.:|||:.:.|||||||||:||:|||||.|:...
  Rat    67 YSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGN 131

  Fly   138 PGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDV 171
            ||||:||||||.:.:|||||||||||:|||:.::
  Rat   132 PGKGNYWTLDPAAADMFDNGSFLRRRKRFKRTEL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 10/59 (17%)
FH 64..152 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.