DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxa3

DIOPT Version :10

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:139 Identity:78/139 - (56%)
Similarity:96/139 - (69%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SASAY---GLGAPHQNKEI----------VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERF 104
            |||.|   |.|..| .||:          .|||||||:||.||||.|..|.:||:.|||:||:.|
Mouse    90 SASGYVAPGPGLVH-GKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLF 153

  Fly   105 PYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK 169
            ||||:|:|.|||||||:||.|:|||||||...||||||||.|.|.|.|||:||.:|||::|||.:
Mouse   154 PYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLE 218

  Fly   170 DVMREKEEA 178
            :..::...|
Mouse   219 EKAKKGNSA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 FH_FOX 69..159 CDD:469596 62/89 (70%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83
FH_FOXA3 117..218 CDD:410814 68/100 (68%)
COG5025 <118..323 CDD:227358 69/110 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.