DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxa2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001277994.1 Gene:Foxa2 / 15376 MGIID:1347476 Length:465 Species:Mus musculus


Alignment Length:388 Identity:129/388 - (33%)
Similarity:170/388 - (43%) Gaps:98/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGYGSASAVAAASSASAAAAA------HYAYDQYSRYPYSASAYGLGAPHQNKEIV--------- 69
            ||....:...|..|.||.||.      |.:.........:|.|.|..||:.|...:         
Mouse    84 AGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGL 148

  Fly    70 ----------------KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSI 118
                            |||||||:||.||||.:.:|.:||:.|||:||:.||:||.|:|.|||||
Mouse   149 SRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSI 213

  Fly   119 RHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKR-- 181
            ||:||.|:||:||.|...||||||:|||.|||.|||:||.:|||::|||     .||:.|:|.  
Mouse   214 RHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK-----CEKQLALKEAA 273

  Fly   182 -----------------QAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGK 229
                             ||.:.|...........|    |:.|.:|......|.     |.||..
Mouse   274 GAASSGGKKTAPGSQASQAQLGEAAGSASETPAGT----ESPHSSASPCQEHKR-----GGLSEL 329

  Fly   230 EVSHAAMLNSCH--DSLAQMNHLAG---GGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLAT 289
            :.:.|:.|:...  .|..|....|.   |...|||...::.:   .|. ||.|:.:..:.:||  
Mouse   330 KGAPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHL---KPE-HHYAFNHPFSINNL-- 388

  Fly   290 VASSQMHHVHHAAAAHHAQ------QLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGP 346
            ::|.|.||..|    ||.|      :....|.|.     |||.|        ||...|...||
Mouse   389 MSSEQQHHHSH----HHHQPHKMDLKAYEQVMHY-----PGGYG--------SPMPGSLAMGP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
Foxa2NP_001277994.1 Forkhead_N 23..164 CDD:254796 15/79 (19%)
FH 165..253 CDD:214627 58/87 (67%)
DUF4799 <224..319 CDD:292674 37/103 (36%)
HNF_C 381..454 CDD:286443 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.