DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxf1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:425 Identity:127/425 - (29%)
Similarity:171/425 - (40%) Gaps:111/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAM 81
            |...|.|:.....|...|...|||.         |..|.....|.    :...||||||||||.|
Mouse     8 QPPHGGGTGGGGGAGGQAMDPAAAG---------PTKAKKTNAGV----RRPEKPPYSYIALIVM 59

  Fly    82 AIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTL 146
            |||::..|::||:.|||::..|||::|...|||:||:||||||||||:|:.:...:||||.|||:
Mouse    60 AIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTI 124

  Fly   147 DPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAH 211
            ||.|..||:.|||.||.|.|::                   |...:||:..|.|| |...|:.. 
Mouse   125 DPASEFMFEEGSFRRRPRGFRR-------------------KCQALKPVYSMVNG-LGFNHLPD- 168

  Fly   212 AAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMN-HLAGGGVEHPGFTVDSLMNVYNPRIHH 275
                      ..|......:|.|....:....|..|| ||||        .||.:          
Mouse   169 ----------TYGFQGSGGLSCAPNSLALEGGLGMMNGHLAG--------NVDGM---------- 205

  Fly   276 SAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHV-AHPLTPGGQGAGGQSSGHSPTT 339
             |.|.|    ::..:.|:..|..........|.:...|.:.| |.||.|.  ||||....|:..:
Mouse   206 -ALPSH----SVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPA--GAGGVMEPHAVYS 263

  Fly   340 ISTPHGPA-------HGGWY------TPETPPSEPV-----------------PHNGQ---QGTP 371
            .|....|.       .|..|      :|..|.:.|:                 .|||.   ||.|
Mouse   264 SSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQGIP 328

  Fly   372 THPGHNNNNS-----SSVLNHNGVGNGGGGGGGGG 401
            .:  |:.:.|     ..|.:.|.:.:......|||
Mouse   329 RY--HSQSPSMCDRKEFVFSFNAMASSSMHTTGGG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 52/85 (61%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 11/49 (22%)
Forkhead 48..133 CDD:306709 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.