DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxf2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_034355.2 Gene:Foxf2 / 14238 MGIID:1347479 Length:446 Species:Mus musculus


Alignment Length:502 Identity:138/502 - (27%)
Similarity:194/502 - (38%) Gaps:170/502 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQN--------KEIVKPPYS 74
            |::...|:||..|:||:::.:|:..|...      :||:.|.||....        :...|||||
Mouse    46 TSSSSSSSSASCASSSSNSVSASAGACKS------AASSGGAGAGSGGTKKATSGLRRPEKPPYS 104

  Fly    75 YIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPG 139
            |||||.||||::..|::||:.|||::..|||::|...|||:||:||||||||||:|:.:...:||
Mouse   105 YIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPG 169

  Fly   140 KGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPL-KLMTNGIL 203
            ||.|||:||.|..||:.|||.||.|.|::                   |...:||: ..:.:|:.
Mouse   170 KGHYWTIDPASEFMFEEGSFRRRPRGFRR-------------------KCQALKPMYHRVVSGLG 215

  Fly   204 EAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNV 268
            ....:......|:..|...|||..........|:.:.:|:        |.|.  ||         
Mouse   216 FGASLLPQGFDFQAPPSAPLGCHGQGGYGGLDMMPAGYDT--------GAGA--PG--------- 261

  Fly   269 YNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSS 333
                   .|:|                ||:||           .||.|::               
Mouse   262 -------HAHP----------------HHLHH-----------HHVPHMS--------------- 277

  Fly   334 GHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGG 398
                        |..|..|....|            .|..|.             |||...||||
Mouse   278 ------------PNPGSTYMASCP------------VPAGPA-------------GVGAAAGGGG 305

  Fly   399 GGG----GGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTG--SLQSASP---------PAS 448
            |||    ..|||.:.|||..|...         .|.....||..  |...|||         |:|
Mouse   306 GGGDYGPDSSSSPVPSSPAMASAI---------ECHSPYTSPAAHWSSPGASPYLKQPPALTPSS 361

  Fly   449 ASVAAASAAAAAAVISSHHHHHHHHAALSGNLGQLGQLSNLSHYRPH 495
            ...|:|....:.:..|....:.|.:|....::|       |..|:.|
Mouse   362 NPAASAGLHPSMSSYSLEQSYLHQNAREDLSVG-------LPRYQHH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 52/85 (61%)
Foxf2NP_034355.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97 14/56 (25%)
FH 100..188 CDD:214627 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..278 12/92 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..325 11/20 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..371 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.