DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxi1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_076396.3 Gene:Foxi1 / 14233 MGIID:1096329 Length:372 Species:Mus musculus


Alignment Length:391 Identity:113/391 - (28%)
Similarity:163/391 - (41%) Gaps:141/391 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYG------------LGAPHQNK--EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIM 101
            |:...|||            |..|.|.:  ::|:|||||.|||||||..|.|:::||:.||||:.
Mouse    84 PFLPQAYGMQRQLLPSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVA 148

  Fly   102 ERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRF 166
            :.||:|..:|.|||||||||||||:||.||.||:..||||:||||||:...|||||:|.|:|:  
Mouse   149 DNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRK-- 211

  Fly   167 KKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEV 231
                  |:.:.:....::.:||         ..||:|.:.....       ||         :||
Mouse   212 ------RKSDSSSSTSSLASEK---------TENGLLASSPKPT-------EP---------QEV 245

  Fly   232 SHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMH 296
            ...|..::...|..:.:..|..|               .|.:::.          |:|:      
Mouse   246 LDTASPDTTTSSPEKRSSPAPSG---------------TPCLNNF----------LSTM------ 279

  Fly   297 HVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEP 361
                .|.......:.|.||      |||               :|                 |||
Mouse   280 ----TAYVSGTNPISRSVA------TPG---------------LS-----------------SEP 302

  Fly   362 VPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSP--TSALGFRDMIFE 424
            :...||...      |.|:.:.:.|.:..||||.             .::|  |:|||:...:|.
Mouse   303 IDKMGQNSL------NFNSYTPLTNLSSHGNGGE-------------WANPVATNALGYGGSVFN 348

  Fly   425 Q 425
            |
Mouse   349 Q 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)
Foxi1NP_076396.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
FH 117..205 CDD:214627 57/87 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..271 20/116 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.