DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and LOC1276571

DIOPT Version :10

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_001688749.2 Gene:LOC1276571 / 1276571 VectorBaseID:AGAMI1_011656 Length:852 Species:Anopheles gambiae


Alignment Length:80 Identity:17/80 - (21%)
Similarity:24/80 - (30%) Gaps:26/80 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PWDRLSITRETYRQ---TRLEQYKNY----------------ENVPNSGESS-------GKDCMA 106
            |||..|.....|.|   |:..::..|                :.|..||:.|       .||.:.
Mosquito   276 PWDYKSAELGKYSQDVTTKFIEFMAYLGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLK 340

  Fly   107 TQKGALFYDFWRNTR 121
            ...|.......||.:
Mosquito   341 EDVGVTTITHQRNEK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 FH_FOX 69..159 CDD:469596 16/79 (20%)
LOC1276571XP_001688749.2 None

Return to query results.
Submit another query.