DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxe1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:421 Identity:134/421 - (31%)
Similarity:182/421 - (43%) Gaps:123/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIV--KPPYSYIALIAMAIQNAAD 88
            :||......:|||.|        ..|..|:..|.|...:.:.:.  ||||||||||||||.:|.:
Mouse    17 AAVKEERGEAAAAGA--------GVPAEAAGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAPE 73

  Fly    89 KKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNM 153
            :::||.|||::|.||||:||||.:.|||||||||:||:||:|:.|:..:||||:||.|||::.:|
Mouse    74 RRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDM 138

  Fly   154 FDNGSFLRRRRRFKKKDV------MREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHA 212
            |::|||||||:|||:.|:      |.:...|....|      |.:.|      |.:.|...|...
Mouse   139 FESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAA------AAIFP------GAVPAARPAYPG 191

  Fly   213 AHF-----------------------------KKEPLM-DLGCLSGKEVSHAAMLNSCHDSLAQM 247
            |.:                             .:.||. |||      .:.:|...||  :.|..
Mouse   192 AVYAGYAPPLAAPPPVYYPAASPGPCRVFGLVPERPLSPDLG------PAPSAAGGSC--AFAAA 248

  Fly   248 NHLAGGGVEHPGFTVDSLMNVYNPRIHHSAY--PYHLNEDNLATVASSQMHHVHHAAAAHHAQQL 310
            ...||.|...|.....:  ...||..:.:||  |    :......|||.:    .||||      
Mouse   249 AGAAGTGSFQPAVCTGA--RPVNPAAYAAAYAGP----DGAYPQGASSAL----FAAAA------ 297

  Fly   311 QRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPG 375
                ..:|.|.:|   .|||.|.|...|.          .:|...:|        ||.|....|.
Mouse   298 ----GRLAGPASP---PAGGGSGGVEATV----------DFYGRTSP--------GQFGAALGPC 337

  Fly   376 HNNNNSSSVLNHNGVGNGGGGGGGGGGGSSS 406
            :|              .||..|.||||...|
Mouse   338 YN--------------PGGQLGAGGGGAYHS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 55/85 (65%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53 8/39 (21%)
FH 55..143 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.