DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxb2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_004921500.2 Gene:foxb2 / 101730239 XenbaseID:XB-GENE-1021718 Length:317 Species:Xenopus tropicalis


Alignment Length:351 Identity:113/351 - (32%)
Similarity:164/351 - (46%) Gaps:78/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||::.:|.:.|:.||::||:||||||:|.|.||||:|||||.|:||:|:.|.
 Frog    13 KPPYSYISLTAMAIQSSQEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:|||||:|.|.||..:||:||||||||:|||   |:|.:..|.|...|::....:....||  
 Frog    78 PDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK---VVRAEHLASKSHQMIHYFHHQHNQTKL-- 137

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDS 264
             ||..:          :..|:..||     .:.|....|     :|.|:.....|.:|| |.:::
 Frog   138 -GIPAS----------EGSPVPSLG-----RLPHFQPYN-----IANMSGSQTSGFKHP-FAIEN 180

  Fly   265 LMN-----------VYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVA 318
            ::.           .....:||..||.   ...|:.:.||...||          .:...:|.:.
 Frog   181 IIGRDYKGVMTGGLPLASMMHHLGYPV---PSQLSNMVSSMWPHV----------GMMDSMASMT 232

  Fly   319 HPLTPGGQGAGGQSSGHSPT----TISTPHGPAHGGWYTPETPPSEPVPH---NGQQGTP----- 371
            .|...|..|...::..|:|:    .:..|..|      |...||...:|.   |.....|     
 Frog   233 VPQEYGHFGVPMKTLCHAPSQTIPAVPLPIKP------TASLPPVSALPSLAVNPSSMCPSPPTV 291

  Fly   372 ---------THPGHNNNNSSSVLNHN 388
                     |||.:..:...|||.|:
 Frog   292 AGTLLEPAVTHPQNKGSMLHSVLVHS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 52/85 (61%)
foxb2XP_004921500.2 FH_FOXB2 1..110 CDD:410817 61/96 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.