DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxq1a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001230273.1 Gene:foxq1a / 100537750 ZFINID:ZDB-GENE-070424-74 Length:312 Species:Danio rerio


Alignment Length:133 Identity:64/133 - (48%)
Similarity:91/133 - (68%) Gaps:5/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSL 124
            |.|:..:.  ||||||||||||||:::...::||..|..|:|::||::|.:..||:||:||||||
Zfish    80 GKPYTRRP--KPPYSYIALIAMAIRDSNSGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSL 142

  Fly   125 NECFVKVARDDKKP-GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAM-MNE 187
            |:||:||.||..:| ||.:||.|:|.|...|.:|.|.|||:|..|| ..||.|..::..|: .|:
Zfish   143 NDCFLKVLRDPSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISKK-TGREPEGPVQTHALDSND 206

  Fly   188 KLA 190
            .:|
Zfish   207 SIA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 48/86 (56%)
foxq1aNP_001230273.1 FH 88..177 CDD:214627 48/88 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.