DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxd2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:314 Identity:105/314 - (33%)
Similarity:149/314 - (47%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNE 126
            |.:| .:|||||||||||.|||..:..|::||:.|.::|..||||||:....||||||||||||:
 Frog    71 PPKN-ALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLND 134

  Fly   127 CFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAE 191
            ||||:.|:...||||:||||||:|.:|||||||||||:|||::              ..||.|.:
 Frog   135 CFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQ--------------QSNEILRD 185

  Fly   192 MKPLKLMTNGI------------LEAKHMAAH-AAHFKKEPL-------------MDLGCLSGKE 230
              |...|....            |:..|...| .|.|..:|.             ..|....|.|
 Frog   186 --PSSFMPAAFGYGPYGYNYGLQLQNYHQHHHTGATFSFQPTHCPLPPPASVFSSPTLSPFLGNE 248

  Fly   231 VSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLM----NVYNPRIHHSAYPYHLNEDNLATVA 291
            ::..:..:....:|..:..|...|...|.|::|:::    :..:|     ..||.:...|...|.
 Frog   249 LTRKSFYSQLSPTLPILQTLKPDGQSRPSFSIDNIIGGSGSTPSP-----TSPYTVQPGNQPPVI 308

  Fly   292 SSQMHHVHHAAAAHHAQQLQRHVAHVAHP-LTPGGQGAGGQSSGHSPTTISTPH 344
                     |..:.....:|.|: :::|. |.|.||....:.     |.:|:.|
 Frog   309 ---------AMLSPSLAPMQNHL-NLSHENLLPSGQNFSSKI-----TNLSSCH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.