DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxm1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_002941428.1 Gene:foxm1 / 100492241 XenbaseID:XB-GENE-854081 Length:754 Species:Xenopus tropicalis


Alignment Length:480 Identity:109/480 - (22%)
Similarity:173/480 - (36%) Gaps:164/480 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRD-NKQGWQNSIRHNLSLNECFVKVAR 133
            :|||||:|||..||.:...|::||..||.:|.:.|||::. .|.||:|||||||||::.||   |
 Frog   262 RPPYSYMALIQFAINSTPRKRMTLKDIYTWIEDHFPYFKHVAKPGWKNSIRHNLSLHDMFV---R 323

  Fly   134 DDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFK-------------KKDVMREKEEAIKRQAMM 185
            :.:...|.||||:.|.:      ...|...:.||             :|.::.:..::::..|..
 Frog   324 ESEANNKVSYWTIHPQA------NRCLTLDQVFKTAVSMSPADDEPQQKKMIPDIRKSLQSAAYA 382

  Fly   186 NEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLM---------DLGCL----SGKEVSHAAML 237
            :.|..:||||....|..|...|...      .:|::         :..||    |.|.|..|.  
 Frog   383 SNKERKMKPLLPRVNSYLIPVHFPV------AQPVLLPATEPYAYEAECLDRHQSSKRVKIAP-- 439

  Fly   238 NSCHDSLAQMNHLAGGGV-EHPGFT---------------------------------------V 262
            .:..|:.....::....| |.|..|                                       .
 Frog   440 KAAADNGESPQYIEPRSVKEEPEITDLNGDVPFRYKQAGSSRRKQQLLPPRSEEPELVLPESSAS 504

  Fly   263 DSLMNV---------YNPRIHHSAY-----PYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRH 313
            ||.::.         .:|..:||::     |::|.::.|:.:|.....::...:.:|..|....:
 Frog   505 DSGLDTDFSFLQDTSAHPSRNHSSHPTQNGPFNLTQEGLSHLAQEGPSYLTQVSFSHFTQDDTSY 569

  Fly   314 VAHVAHPL-----------TPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTP-ETP---PSEPV- 362
            :.. .:|:           ||      .:.....|...|||..|...|...| ||.   |.:|| 
 Frog   570 LTQ-ENPIQITQDEDYTFKTP------IKDRFSKPPASSTPSKPTDTGLLQPSETEVCLPRDPVL 627

  Fly   363 ---PHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDM-IF 423
               |....||:...|..:|..:.|                        ...:|     |:|. :|
 Frog   628 DFSPVRIPQGSTFTPFKDNLGTLS------------------------FGDTP-----FKDFGLF 663

  Fly   424 EQNQSCQLDTGSPTGSLQSASPPAS 448
                      |||...|.:.||.||
 Frog   664 ----------GSPQNLLNTLSPAAS 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 40/86 (47%)
foxm1XP_002941428.1 FH 262..337 CDD:238016 39/77 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.