DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:269 Identity:87/269 - (32%)
Similarity:134/269 - (49%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YSRYPYSASAY-GLGAP----HQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPY 106
            :::|||:...| |...|    .:.|:..:|.||||||||||||.:.|.||||:|||.:||::|||
 Frog     4 HTQYPYNCFNYDGDDYPACSSDEEKKFNRPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKFPY 68

  Fly   107 YRDNKQGWQNSIRHNLSLNECFVKVAR-DDKKPGKGSYWTLDPDSYNM---FDNGSFLRRRRRFK 167
            ||.|::.||||||||||||.|||||.| :..:.|||:||:......:|   |:||::.|||||..
 Frog    69 YRSNQRAWQNSIRHNLSLNSCFVKVPRTEGNEKGKGNYWSFASGCESMLDLFENGNYKRRRRRRN 133

  Fly   168 KKDVMREKEEAIKRQAMM----------------NEKLAEMKPLKLMTNGILEAKHMAAHAAHFK 216
            .|...:::::. :.||:.                |||..|....::.|:.:..            
 Frog   134 MKKCQKDRKQN-QAQALHPGEFSTSSSTAHVIYGNEKRTESTSRQMETDSLYP------------ 185

  Fly   217 KEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNP----RIHHSA 277
                     :|.::...::.|               |..:...|::|.:::..:|    |..|:.
 Frog   186 ---------ISNRQSQTSSSL---------------GKSDEIKFSIDYILSAPDPLPVLRSQHNV 226

  Fly   278 Y--PYHLNE 284
            .  .||:.|
 Frog   227 LDNKYHMVE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/89 (61%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 53/85 (62%)
COG5025 33..>224 CDD:227358 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.