DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:311 Identity:107/311 - (34%)
Similarity:143/311 - (45%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||:|||||||:.:|:|::||:.|||||:.:||:|..||:||||||||||||||||:||.|:
 Frog    70 KPPYSYVALIAMAIRESAEKRLTLSAIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPRE 134

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            .....||:||||||...:||:.|:: |||||.|:                      ..:|     
 Frog   135 GGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKR----------------------PFRP----- 171

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQ----MNH----LAGGGVE 256
                ...|..|..:.|..:   ..|.||..:...:..:|:.. .|||    |::    :|||.|.
 Frog   172 ----PPTHFQAGKSLFSSD---TYGYLSPPKYLQSTFMNNSW-PLAQPPAPMSYTSCQMAGGNVS 228

  Fly   257 HPGFTVDSLMNVYNP--RIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAH 319
            .......|..:.|:|  |:...:.|..:|..|    ..|..||.|    |||||||         
 Frog   229 PVNVKGLSASSSYSPYSRVQSMSLPSMVNSYN----GMSHHHHPH----AHHAQQL--------- 276

  Fly   320 PLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGT 370
                                  :|..||          |:.|.|.||.|.|
 Frog   277 ----------------------SPASPA----------PAPPAPPNGVQFT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 55/84 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.