DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl2b

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:423 Identity:109/423 - (25%)
Similarity:149/423 - (35%) Gaps:193/423 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||:|||||||:.:.:|::||:||||||:.:||:|..||:||||||||||||||||:||.|:
Zfish    42 KPPYSYVALIAMAIRESTEKRLTLSGIYQYIITKFPFYEKNKKGWQNSIRHNLSLNECFIKVPRE 106

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            .....||:||||||...:||:.|:: |||||.|                         :|.:   
Zfish   107 GGGERKGNYWTLDPACEDMFEKGNY-RRRRRMK-------------------------RPFR--- 142

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDS 264
                      ..||||:          :||.                   |.||           
Zfish   143 ----------PPAAHFQ----------AGKS-------------------LFGG----------- 157

  Fly   265 LMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAG 329
                       .||                                                   
Zfish   158 -----------DAY--------------------------------------------------- 160

  Fly   330 GQSSGHSPTTISTPHGPAHGGWYTPETPP------SEPVPHNGQQG------TPTHPGHNNNNSS 382
               :|:.|.......|..:..|..|:.||      |..:| ||..|      ||::      |..
Zfish   161 ---TGYLPAPKYLQSGFMNSSWPLPQPPPPAMSYASCQMP-NGNMGAMKALSTPSY------NPY 215

  Fly   383 SVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPA 447
            |.:...|:.|.....||.|                       .:|       .|....|||:|..
Zfish   216 SRMQAMGLPNMMNSYGGMG-----------------------HHQ-------QPQHQQQSAAPSN 250

  Fly   448 SASVAAASAAAAAAVISSHHHHHHHHAALSGNL 480
            ||:....:.:...|.:.|:..|....:||...:
Zfish   251 SAAALQFTCSRQPAELYSYWEHEAKSSALHSRI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.