DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxg1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:357 Identity:114/357 - (31%)
Similarity:156/357 - (43%) Gaps:67/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSL 124
            |...:|.:..|||:||.|||.|||:.:.:|::||||||::||:.|||||:|||||||||||||||
 Frog   114 GGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSL 178

  Fly   125 NECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKL 189
            |:|||||.|....||||:||.|||.|.::|..|:..:.||                |......||
 Frog   179 NKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRR----------------RSTTSRAKL 227

  Fly   190 AEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSC----------HDSL 244
            |..:..:|.:.|:.....  |.:.::...|.:.   |.....|.|...|..          :.|:
 Frog   228 AFKRGARLTSTGLTFMDR--AGSLYWPMSPFLS---LHHPRASSALSYNGTTSAYPSHPMPYSSV 287

  Fly   245 AQMNHLAGGGVEHP-----GFTVDSLMNVYNPRIHHSAYPYHLNEDNLAT-------VASSQMHH 297
            ...|.|   |..|.     |.:||.|:|...|...|     ||....||.       |..|..:.
 Frog   288 LTQNSL---GSNHSFSTSNGLSVDRLVNGEIPYATH-----HLTAAALAASVPCGLPVPCSGTYS 344

  Fly   298 VHHAAAAHHAQQLQRHVAHVAHP-------LTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPE 355
            ::..:....|.|......||.||       .:...:.|...:|..:|:|:     |...  ..|.
 Frog   345 LNPCSVNLLAGQTGYFFPHVPHPSITSQSSTSMAARAASSSTSPQAPSTL-----PCES--LRPA 402

  Fly   356 TPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNH 387
            .|........|.....||  .|..:||:.|.|
 Frog   403 LPSFTTGLSGGLSDYFTH--QNQGSSSNSLIH 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/85 (68%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.