DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxb1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001107970.1 Gene:foxb1 / 100125219 XenbaseID:XB-GENE-1018255 Length:322 Species:Xenopus tropicalis


Alignment Length:395 Identity:123/395 - (31%)
Similarity:176/395 - (44%) Gaps:99/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||::.:|.:.|:.||::||:||||||:|.|.||||:|||||.|:||:|:.|.
 Frog    13 KPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:|||||:|.|.|...:||:||||||||:|||   ||:....|..:.:...:.|.:...|:|..
 Frog    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK---VMKSDHLAPSKASDAAQYLQQQAKLRLSA 139

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDS 264
                    :||...|..:....:||........|...:.:.   :|:...:.||          .
 Frog   140 --------LAASGTHLPQMSTYNLGVSQTSSFKHPFAIENI---IAREYKMPGG----------L 183

  Fly   265 LMNVYNPRIHHSAYPYHLNEDNLATVASS---QMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQ 326
            ..:...|.  .:|||.|   :.|.||.||   ...|::.::              :....||...
 Frog   184 AFSTMQPM--PAAYPLH---NQLTTVGSSIGTGWPHMYSSS--------------MLDTTTPISM 229

  Fly   327 GAGGQSSGHSPTTISTPHGP-AHGGWYTPETPPSEPVPHN-------GQQGTPTH-PGHNNNNSS 382
            |    :|.:|.:....|..| .||.    :|.|:.|||..       .....||| |...:|:|.
 Frog   230 G----NSDYSVSAYGVPIKPICHGA----QTLPAIPVPIKPTLASVPALPALPTHIPAILSNSSP 286

  Fly   383 SVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPA 447
            |:                          ||||         .|..:.|....:|:.:|.| .|.|
 Frog   287 SL--------------------------SPTS---------PQTATSQSSPATPSDTLTS-PPTA 315

  Fly   448 SASVA 452
            ..|||
 Frog   316 LLSVA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/85 (60%)
foxb1NP_001107970.1 FH 13..101 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.